SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4k4h_E from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4k4h_E
Domain Number 1 Region: 147-331
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 5.62e-82
Family DNA polymerase beta-like 0.000000504
Further Details:      
 
Domain Number 2 Region: 6-84
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 4.91e-34
Family DNA polymerase beta, N-terminal domain-like 0.0000538
Further Details:      
 
Domain Number 3 Region: 87-141
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 6.41e-18
Family DNA polymerase beta-like, second domain 0.0000777
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4k4h_E
Sequence length 340
Comment mol:protein length:340 DNA polymerase lambda
Sequence
mssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsip
gigkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledi
rsqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgka
tcgdvdvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpgpg
rrhrrldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgc
kvgpgrvlptptekdvfrllglpyrepaerdwlehhhhhh
Download sequence
Identical sequences 4k4g_A 4k4g_E 4k4g_I 4k4g_M 4k4h_A 4k4h_E 4k4h_I 4k4h_M 4k4i_A 4k4i_E 4k4i_I 4k4i_M

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]