SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4omz_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4omz_A
Domain Number 1 Region: 14-101
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.81e-35
Family SCOPe 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4omz_A
Sequence length 118
Comment mol:protein length:118 NolR
Sequence
MEHAMQPLSPEKHEEAEIAAGFLSAMANPKRLLILDSLVKEEMAVGALANKVGLSQSALS
QHLSKLRAQNLVSTRRDAQTIYYSSSSDSVMKILGALSEIYGAATSVVIEKPFVRKSA
Download sequence
Identical sequences Q83TD2
4omy_A 4omy_B 4omy_C 4omy_D 4omz_A 4omz_B 4omz_C 4omz_D 4omz_E 4omz_F 4omz_G 4omz_H 4on0_A 4on0_B 4on0_C 4on0_D cath|current|4omzA00/6-103 cath|current|4omzC00/5-104 cath|current|4omzF00/6-103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]