SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4peu_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4peu_A
Domain Number 1 Region: 99-119,159-264
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000387
Family Galacturonase 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4peu_A
Sequence length 313
Comment mol:protein length:313 Uncharacterized protein
Sequence
mgahavsikklilaasilttlaltgcggkgavqpsgvstgdvnakivfdndkvnadnvdg
lsvserevkitkpgmytfsgtwndgqilvdigkefeavlvldgvnitntksapiyiksae
kvkieladgkdnvltdaefyefedpqdnkpnaciysrdditikgngnltvnanfnngigt
sndlkitggnitvkafnnglkgngsvtisggniditagadgikventeephkgyvnitgg
tikirakddaidsvrsvsinnadvkvsvggkdvkcegvlniaegclgkleeasgkpipnp
llgldsthhhhhh
Download sequence
Identical sequences 4peu_A 4phb_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]