SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4phe_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4phe_A
Domain Number 1 Region: 147-327
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.52e-66
Family DNA polymerase beta-like 0.0000000246
Further Details:      
 
Domain Number 2 Region: 6-83
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 1.39e-31
Family DNA polymerase beta, N-terminal domain-like 0.0000186
Further Details:      
 
Domain Number 3 Region: 86-141
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 1.19e-16
Family DNA polymerase beta-like, second domain 0.0000934
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4phe_A
Sequence length 329
Comment mol:protein length:329 DNA polymerase beta
Sequence
pqetlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvg
tkiaekideflatgklrklekirqddtsssinfltrvsgigpsaarkfvdegiktledlr
knedklnhhqriglkyfgdfekripreemlqmqdivlnevkkvdseyiatvcgsfrrgae
ssgdmdvllthpsftsestkqpkllhqvveqlqkvhfitdtlskgetkfmgvcqlpsknd
ekeyphrridirlipkdqyycgvlyftgsdifnknmrahalekgftineytirplgvtgv
ageplpvdsekdifdyiqwkyrepkdrse
Download sequence
Identical sequences 4mf8_A 4nlk_A 4nln_A 4nlz_A 4nm1_A 4nm2_A 4o5c_A 4o5e_A 4pgq_A 4pgy_A 4pha_A 4phd_A 4phe_A 4tup_A 4tur_A 5hhi_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]