SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4rm6_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4rm6_A
Domain Number 1 Region: 25-259,286-303
Classification Level Classification E-value
Superfamily Pectin lyase-like 7.03e-35
Family Filamentous hemagglutinin FhaB, secretion domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4rm6_A
Sequence length 884
Comment mol:protein length:884 Heme/hemopexin-binding protein
Sequence
SARDLPQGSSVVVGEANVSTIGNKMTIDQKTPTTQIDWHSFDIGQNKEVEFKQPDANSVA
YNRVTGGNASQIQGKLTANGKVYLANPNGVIITQGAEINVAGLFATTKDLERISENGNGN
GNKFTRKLKDGQVVKEGQVINKGKIKAKDFVVLNGDKVINEGEIDATNNGKVYLSSGYNF
TFTLSDSSISVALEDNAVQSIVQNEGIIKAGDITLNAKGRNQALDSLVMNNGVLEATKVS
NKNGKVVLSADDVQLNNKSDIKGESEVVFTNEPKNKIKITSQTGSKVTSPKINFTGKSVN
INGDFGRDDSKAHYNEEHKRLDTEVNIDVPDNENIRIAEKDNTGTGTGTDSFIQTGALSS
LLANNGKVNLKGKDVNISGRIHIDSFRGSDSLLKLTNQGHIKINHADIHSTGRLFFITSL
QNEKDSQSDITITDSKINLGNGAMGLGRSLDKENCDNQRWCRTETSQRKKFDVHMRNVVF
DQVDDVVVAGGFKKVNLDNIVATGKTNFYIDGGVSRNNSRYEYGVLDLDKRTLLSELDQR
RRRWKYYNDLDLDMNKAYWHRFDMFATKNTGRSTIKDTEINISNSKINLKNGFVHLLAEK
IKLDNSKIDITFDKDNSQDISTQINRLGMNGKVSMVNSHIKIVGDEKSDISAKAPYATMF
LIGELIGEKSSIFVKSHQGYTFRTDGDTKIAGKNSKDDLKITAINTGGRTGKEVIINGAP
GSIDNDANIANMAFTIGDNANTKTTIENADITALAPNGGTAYLSSKGVEIEVNPNSNFTF
FELPREKNFNQTKIKGDSTKLSERGFARLYDKINGVRASNLSAEQLNVTDASEKIINTKL
VSSLDVEKLVSVAVSDAGKGSEEQQFGDKGNNTKVSVGELETEQ
Download sequence
Identical sequences 4rm6_A 4rt6_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]