SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4ru4_E from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4ru4_E
Domain Number 1 Region: 56-123,201-379
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.05e-23
Family iota-carrageenase 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4ru4_E
Sequence length 602
Comment mol:protein length:602 tail spike protein gp49
Sequence
GSVGQSLQFLEMGRVTPAQFGAVGDGASHPLSERYATLAEAQTVYPHAVALSDEIDWAAL
QAAVDSGAPVHIPSGDYQINRGISSTGSLQIAGDGATSIIRPTAAFTGTSVLSCVGSLVA
LPNISSVSAGSLTIDFASTPNLVAGDVFIIYNPTDSSFSGFRTSYRAGEFCEVRAVSGNT
VTIRSALYAAYDGATVAIYKVVSGVVDIASIQIVGGTVPMNGLLVEAVVSPRVDDVTVTL
ANNAGVYFARCYDAKITNSNISNIGDGGDDYGIIFGNCHDGGADNCKVYARRHAIATGGD
AEVGCVPVRNVRMRNCTLRNDITSGTHCADFHGNAEDCSYENCTIYGGATWQGKDISYRH
CTITNASGGWIVISAEILGGTFLLDQCTLYTTGDPQPGNRGVIDVGGNSAVLTTNTTQPC
NFLIQGGSLRAPSLSTSSYLLRARLEGSTVPVNIQYSGQAIDVGSLGKVLQLDITSGSTS
PEYLIVENLAGLPSGITLASAAGGFASAPMRMPVLGGRVQVTTATNASSVTAPVTFRYIY
PKAPTVQVTKTDRSYAGNRVGVAIANPTSASGATLGLFTDDGTNFSSAVTNQLNWQAGIY
EV
Download sequence
Identical sequences 4ru4_A 4ru4_B 4ru4_C 4ru4_D 4ru4_E 4ru4_F

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]