SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4u4b_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4u4b_A
Domain Number 1 Region: 121-302
Classification Level Classification E-value
Superfamily Pectin lyase-like 6.69e-33
Family Pectate lyase-like 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4u4b_A
Sequence length 347
Comment mol:protein length:347 Pectate lyase
Sequence
MFKYLTPIFLCTAAISFQAQADDTMLMLLKKDNATYLSWSTDAGNVVRQDVYRSTSSAQA
GSEKIAELNSSDRTFTDLTANPQSDYWYWVDTVSGNNSVLKSNAASTAPAPLRAAPLKAA
SPECKAGAVIKDKTVDCGGITLGLSCSGDSDKQPPVITLENATIKNLRISEKGGSDGIHC
KSGNCRIENVIWEDICEDAATNLGKTMTIVGGVAHNTTNGPGGKPDKVLQQNAKNSHTIV
QGNFTLTGQHGKLWRSCGDCTNNGGPRNLTIISATVNGTIDSIAGVNRNFGDVAEIRDLR
IKGYKEGKPPVCEEFNGVEKGKGKSDKYGEFWDTKNCKVSRSNVKPL
Download sequence
Identical sequences A0A221TD42
4u49_A 4u49_B 4u4b_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]