SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4u4n_l2 from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4u4n_l2
Domain Number 1 Region: 98-244
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 3.78e-50
Family C-terminal domain of ribosomal protein L2 0.00000765
Further Details:      
 
Domain Number 2 Region: 1-96
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.9e-17
Family Cold shock DNA-binding domain-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4u4n_l2
Sequence length 253
Comment mol:protein length:253 60S ribosomal protein L2-A
Sequence
GRVIRNQRKGAGSIFTSHTRLRQGAAKLRTLDYAERHGYIRGIVKQIVHDSGRGAPLAKV
VFRDPYKYRLREEIFIANEGVHTGQFIYAGKKASLNVGNVLPLGSVPEGTIVSNVEEKPG
DRGALARASGNYVIIIGHNPDENKTRVRLPSGAKKVISSDARGVIGVIAGGGRVDKPLLK
AGRAFHKYRLKRNSWPKTRGVAMNPVDHPHGGGNHQHIGKASTISRGAVSGQKAGLIAAR
RTGLLRGSQKTQD
Download sequence
Identical sequences B3LTM6
1s1iB SCRT_05198 4u3m_L2 4u3m_l2 4u3n_L2 4u3n_l2 4u3u_L2 4u3u_l2 4u4n_L2 4u4n_l2 4u4o_L2 4u4o_l2 4u4q_L2 4u4q_l2 4u4r_L2 4u4r_l2 4u4u_L2 4u4u_l2 4u4y_L2 4u4y_l2 4u4z_L2 4u4z_l2 4u50_L2 4u50_l2 4u51_L2 4u51_l2 4u52_L2 4u52_l2 4u53_L2 4u53_l2 4u55_L2 4u55_l2 4u56_L2 4u56_l2 4u6f_L2 4u6f_l2 4v4b_BB 4v8y_BA 4v8z_BA 5dat_L2 5dat_l2 5dc3_L2 5dc3_l2 5dge_L2 5dge_l2 5dgf_L2 5dgf_l2 5dgv_L2 5dgv_l2 5fci_L2 5fci_l2 5fcj_L2 5fcj_l2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]