SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4u4o_c4 from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4u4o_c4
Domain Number 1 Region: 9-134
Classification Level Classification E-value
Superfamily Translational machinery components 8.57e-36
Family Ribosomal protein L18 and S11 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4u4o_c4
Sequence length 136
Comment mol:protein length:136 40S ribosomal protein S14-A
Sequence
SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAM
LAAQDVAAKCKEVGITAVHVKIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPV
PSDSTRKKGGRRGRRL
Download sequence
Identical sequences cath|current|4ujfP00/11-137 cath|current|4ujhs00/10-137 cath|current|4ujkP00/11-137 cath|current|4ujms00/10-137 cath|current|4ujpP00/11-137 cath|current|4ujrs00/10-137 cath|current|4ujuP00/11-137 cath|current|4ujws00/10-137 cath|current|4ujzP00/11-137 cath|current|4uk1s00/10-137 cath|current|4uk4P00/11-137 cath|current|4uk6s00/10-137 cath|current|4uk9P00/11-137 cath|current|4ukbs00/10-137 cath|current|4ukfP00/11-137 cath|current|4ukhs00/10-137 cath|current|4ukkP00/11-137 cath|current|4ukms00/10-137 cath|current|4ukpP00/11-137 cath|current|4ukrs00/10-137 cath|current|4ukuP00/11-137 cath|current|4ukws00/10-137 cath|current|4ukzP00/11-137 cath|current|4ul1s00/10-137 cath|current|4ul4P00/11-137 cath|current|4ul6s00/10-137 cath|current|4ul9P00/11-137 cath|current|4ulbs00/10-137 cath|current|4uleP00/11-137 cath|current|4ulgs00/10-137 cath|current|4uljP00/11-137 cath|current|4ulms00/10-137 cath|current|4ulpP00/11-137 cath|current|4ulrs00/10-137 4u3m_C4 4u3m_c4 4u3n_C4 4u3n_c4 4u3u_C4 4u3u_c4 4u4n_C4 4u4n_c4 4u4o_C4 4u4o_c4 4u4q_C4 4u4q_c4 4u4r_C4 4u4r_c4 4u4u_C4 4u4u_c4 4u4y_C4 4u4y_c4 4u4z_C4 4u4z_c4 4u50_C4 4u50_c4 4u51_C4 4u51_c4 4u52_C4 4u52_c4 4u53_C4 4u53_c4 4u55_C4 4u55_c4 4u56_C4 4u56_c4 4u6f_C4 4u6f_c4 5dat_C4 5dat_c4 5dc3_C4 5dc3_c4 5dge_C4 5dge_c4 5dgf_C4 5dgf_c4 5dgv_C4 5dgv_c4 5fci_C4 5fci_c4 5fcj_C4 5fcj_c4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]