SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4u55_c0 from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4u55_c0
Domain Number 1 Region: 42-84
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000017
Family SCOPe 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4u55_c0
Sequence length 105
Comment mol:protein length:105 40S ribosomal protein S10-A
Sequence
MLMPKEDRNKIHQYLFQEGVVVAKKDFNQAKHEEIDTKNLYVIKALQSLTSKGYVKTQFS
WQYYYYTLTEEGVEYLREYLNLPEHIVPATYIQERNPTQRPQRRY
Download sequence
Identical sequences 4u3m_C0 4u3m_c0 4u3n_C0 4u3u_C0 4u3u_c0 4u4n_C0 4u4n_c0 4u4o_C0 4u4o_c0 4u4q_C0 4u4q_c0 4u4r_C0 4u4r_c0 4u4u_C0 4u4u_c0 4u4y_C0 4u4y_c0 4u4z_C0 4u4z_c0 4u50_C0 4u50_c0 4u51_C0 4u51_c0 4u52_C0 4u52_c0 4u53_C0 4u53_c0 4u55_C0 4u55_c0 4u56_C0 4u56_c0 5dc3_c0 5dge_C0 5dge_c0 5dgv_C0 5dgv_c0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]