SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4u55_d8 from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4u55_d8
Domain Number 1 Region: 4-66
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.72e-25
Family Cold shock DNA-binding domain-like 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4u55_d8
Sequence length 66
Comment mol:protein length:66 40S ribosomal protein S28-A
Sequence
DNKTPVTLAKVIKVLGRTGSRGGVTQVRVEFLEDTSRTIVRNVKGPVRENDILVLMESER
EARRLR
Download sequence
Identical sequences 4u3m_D8 4u3m_d8 4u3n_D8 4u3n_d8 4u3u_D8 4u3u_d8 4u4n_D8 4u4n_d8 4u4o_D8 4u4o_d8 4u4q_D8 4u4q_d8 4u4r_D8 4u4r_d8 4u4u_D8 4u4u_d8 4u4y_D8 4u4y_d8 4u4z_D8 4u4z_d8 4u50_D8 4u50_d8 4u51_D8 4u51_d8 4u52_D8 4u52_d8 4u53_D8 4u53_d8 4u55_D8 4u55_d8 4u56_D8 4u56_d8 4u6f_D8 4u6f_d8 5dat_D8 5dat_d8 5dc3_D8 5dc3_d8 5dge_D8 5dge_d8 5dgf_D8 5dgf_d8 5dgv_D8 5dgv_d8 5fci_D8 5fci_d8 5fcj_D8 5fcj_d8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]