SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4uer_E from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4uer_E
Domain Number 1 Region: 2-207
Classification Level Classification E-value
Superfamily PDB 8.27e-105
Family PDB 0.00000000523
Further Details:      
 
Domain Number 2 Region: 37-108
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.65e-20
Family Ribosomal S5 protein, N-terminal domain 0.00074
Further Details:      
 
Domain Number 3 Region: 119-199
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.05e-20
Family Translational machinery components 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4uer_E
Sequence length 217
Comment mol:protein length:217 US5
Sequence
GWVPVTKLGRLVKAGKITTIEEIFLHSLPVKEFQIIDTLLPGLQDEVMNIKPVQKQTRAG
QRTRFKAVVVVGDSNGHVGLGIKTAKEVAGAIRAGIIIAKLSVIPIRRGYWGTNLGQPHS
LATKTTGKCGSVTVRLIPAPRGSGIVASPAVKKLLQLAGVEDVYTQSNGKTRTLENTLKA
AFVAIGNTYGFLTPNLWAEQPLPVSPLDIYSDEASAQ
Download sequence
Identical sequences A0A0J9X207
4uer_E 5i4l_S2 5i4l_s2 5lyb_S2 5lyb_s2 5m1j_C2 5mei_D 5mei_s2 5ndg_S2 5ndg_s2 5ndv_S2 5ndv_s2 5ndw_S2 5ndw_s2 5obm_S2 5obm_s2 5on6_D 5on6_s2 5tbw_D 5tbw_s2 5tga_S2 5tga_s2 5tgm_S2 5tgm_s2 6gq1_s 6gqb_s 6gqv_s

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]