SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4v19_D from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4v19_D
Domain Number 1 Region: 180-295
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 2.55e-35
Family C-terminal domain of ribosomal protein L2 0.00011
Further Details:      
 
Domain Number 2 Region: 71-169
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.9e-24
Family Cold shock DNA-binding domain-like 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4v19_D
Sequence length 306
Comment mol:protein length:306 MITORIBOSOMAL PROTEIN UL2M, MRPL2
Sequence
MALRVLTRALSSLSLTPRIAVAPGLNLLPAVQVTNNVLLTLPSGLMSLPCRPILTSVALS
ATSVSWKSRTKYTVMPVKMRKSGGRNHTGQIQVHGIGGGHKQRYRMIDFLRFRPEHESKP
GPFEEKVIAVRYDPCRSADIALVAGGNRKRWIIATENMKAGDTVLNSDHIGRMAVAAREG
DAHPLGALPVGTLINNVESEPGRGAQYIRAAGTCGVLLRKVNGTAIIQLPSKRQMQVLET
CIATVGRVSNVDHNKRVIGKAGRNRWLGKRPNSGLWQRKGGWAGRKIRPLPPMKSYVKLP
SAAAQS
Download sequence
Identical sequences F1RRN2
ENSSSCP00000001802 4ce4_D 4v19_D 5aj4_BD 6gaw_BD 6gb2_BD 9823.ENSSSCP00000001802 ENSSSCP00000001802 NP_001171996.1.46622 XP_020953634.1.46622 XP_020953635.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]