SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4v4g_DJ from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4v4g_DJ
Domain Number 1 Region: 2-71
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 4.69e-28
Family Ribosomal L11/L12e N-terminal domain 0.0000132
Further Details:      
 
Domain Number 2 Region: 66-139
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 5.93e-27
Family Ribosomal protein L11, C-terminal domain 0.0000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4v4g_DJ
Sequence length 143
Comment mol:protein length:143 50S ribosomal protein L11
Sequence
mkkvagivklqlpagkatpappvgpalgqyganimeftkafnaqtadkgdaiipveitiy
adrsftfitktppmsylirkaagigkgsstpnkakvgklnwdqvleiaktkmpdlnagsv
eaaantvagtarsmgvtveggpn
Download sequence
Identical sequences 4v49_BG 4v4a_BG 4v4g_BJ 4v4g_DJ 4v4g_FJ 4v4g_HJ 4v4g_JJ 1pnuG

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]