SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4v6n_BL from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4v6n_BL
Domain Number 1 Region: 4-129
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.3e-49
Family Translational machinery components 0.00000031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4v6n_BL
Sequence length 129
Comment mol:protein length:129 30S ribosomal protein S9
Sequence
aenqyygtgrrkssaarvfikpgngkivinqrsleqyfgretarmvvrqplelvdmvekl
dlyitvkgggisgqagairhgitralmeydeslrselrkagfvtrdarqverkkvglrka
rrrpqfskr
Download sequence
Identical sequences 3j9z_SI 3ja1_SI 4adv_I 4v47_BI 4v48_BI 4v4q_AI 4v4q_CI 4v50_AI 4v50_CI 4v52_AI 4v52_CI 4v53_AI 4v53_CI 4v54_AI 4v54_CI 4v55_AI 4v55_CI 4v56_AI 4v56_CI 4v57_AI 4v57_CI 4v5b_BI 4v5b_DI 4v5y_AI 4v5y_CI 4v64_AI 4v64_CI 4v6m_AI 4v6n_BL 4v6o_AL 4v6p_AL 4v6q_AL 4v6r_AL 4v6s_BK 4v6v_AI 4v7c_AI 4v7d_BI 5h5u_p 5my1_I 001550738|e4v6kBM1|212.1.1.101|BM:2-130 001550741|e4v6lAM1|212.1.1.101|AM:2-130 001550743|e4v6mAI1|212.1.1.101|AI:1-129 001550745|e4v6nBL1|212.1.1.101|BL:1-129 001550747|e4v6oAL1|212.1.1.101|AL:1-129 001550750|e4v6pAL1|212.1.1.101|AL:1-129 001550752|e4v6qAL1|212.1.1.101|AL:1-129 001550755|e4v6rAL1|212.1.1.101|AL:1-129 001550757|e4v6sBK1|212.1.1.101|BK:1-129 001550762|e4v6vAI1|212.1.1.101|AI:1-129 001564374|e3j9zSI1|212.1.1.101|SI:1-129 001564422|e3ja1SI1|212.1.1.101|SI:1-129 cath|current|2avyI00/3-129 cath|current|2aw7I00/3-129 cath|current|2i2pI00/3-129 cath|current|2i2uI00/3-129 cath|current|2qalI00/3-129 cath|current|2qanI00/3-129 cath|current|2qb9I00/3-129 cath|current|2qbbI00/3-129 cath|current|2qbdI00/3-129 cath|current|2qbfI00/3-129 cath|current|2qbhI00/3-129 cath|current|2qbjI00/3-129 cath|current|2qouI00/3-129 cath|current|2qowI00/3-129 cath|current|2qoyI00/3-129 cath|current|2qp0I00/3-129 cath|current|2vhoI00/3-129 cath|current|2vhpI00/3-129 cath|current|3df1I00/3-129 cath|current|3df3I00/3-129 2qalI

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]