SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4v9q_AD from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4v9q_AD
Domain Number 1 Region: 126-270
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1.66e-60
Family C-terminal domain of ribosomal protein L2 0.000000051
Further Details:      
 
Domain Number 2 Region: 1-124
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.99e-54
Family Cold shock DNA-binding domain-like 0.000000237
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4v9q_AD
Sequence length 271
Comment mol:protein length:271 50S ribosomal protein L2
Sequence
avkkfkpytpsrrfmtvadfseitktepekslvkplkktggrnnqgritvrfrggghkrl
yriidfkrwdkvgipakvaaieydpnrsariallhyvdgekryiiapdglqvgqqvvagp
dapiqvgnalplrfipvgtvvhavelepkkgaklaraagtsaqiqgregdyvilrlpsge
lrkvhgecyatvgavgnadhknivlgkagrsrwlgrrphvrgaamnpvdhphgggegrap
rgrppaspwgwqtkglktrkrrkpssrfiia
Download sequence
Identical sequences 4v83_BC 4v83_DC 4v84_BC 4v84_DC 4v9i_BD 4v9i_DD 4v9n_BD 4v9n_DD 4v9q_AD 4v9q_CD 4wt8_CB 4wt8_DB 4xej_AL02 4xej_BL02 5d8b_A 5d8b_WA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]