SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4wfn_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4wfn_A
Domain Number 1 Region: 127-273
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 3.44e-59
Family C-terminal domain of ribosomal protein L2 0.0000000615
Further Details:      
 
Domain Number 2 Region: 2-124
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.12e-49
Family Cold shock DNA-binding domain-like 0.00000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4wfn_A
Sequence length 275
Comment mol:protein length:275 50S ribosomal protein L2
Sequence
MAVKKYRPYTPSRRQMTTADFSGLTKKRPEKALTEALPKTGGRNNRGRITSRFIGGGHKR
LYRIIDFKRRDKSGVNAKVAAIEYDPNRSARIALLHYADGEKRYILAPEGLTVGATVNAG
PEAEPKLGNALPLRFVPVGAVVHALELVPGKGAQLARSAGTSVQVQGKESDYVIVRLPSG
ELRRVHSECYATIGAVGNAEHKNIVLGKAGRSRWLGRKPHQRGSAMNPVDHPHGGGEGRT
GAGRVPVTPWGKPTKGLKTRRKRKTSDRFIVTRRK
Download sequence
Identical sequences Q9RXJ9
gi|15805343|ref|NP_294037.1| 1nkwA NP_294037.1.55610 WP_010886959.1.45201 WP_010886959.1.61927 WP_010886959.1.86829 1nkw_A 1sm1_A 4u67_A 4wfn_A 5jvg_A 5jvh_A 243230.DR_0314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]