SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4y1u_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4y1u_A
Domain Number 1 Region: 31-153
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.28e-49
Family Galectin (animal S-lectin) 0.0000323
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4y1u_A
Sequence length 154
Comment mol:protein length:154 Galectin-1
Sequence
MGSSHHHHHHSSGLVPRGSHMCGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNN
LCLHFNPRFNAHGDANTIVCNSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKL
PDGYEFKFPNRLNLEAINYMAADGDFKIKCVAFD
Download sequence
Identical sequences 4y1u_A 4y1u_B 4y1v_A 4y1v_B 4y1x_A 4y1x_B 4y1z_A 4y1z_B 4y20_A 4y20_B 4y22_A 4y22_B 4y24_A 4y24_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]