SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4ygd_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4ygd_B
Domain Number 1 Region: 20-102
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000212
Family Calmodulin-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4ygd_B
Sequence length 104
Comment mol:protein length:104 Multiple coagulation factor deficiency protein 2
Sequence
mghhhhhhhhhhssghiegrhmlemspqelqlhyfkmhdydgnnlldglelstaithvhk
eegseqaplmsedeliniidgvlrdddknndgyidyaefakslq
Download sequence
Identical sequences 3wht_B 3whu_B 3wnx_B 4ygb_B 4ygb_D 4ygc_B 4ygc_D 4ygc_F 4ygc_H 4ygd_B 4ygd_D 4ygd_F 4ygd_H

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]