SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5ca7_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5ca7_B
Domain Number 1 Region: 149-333
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 5.27e-82
Family DNA polymerase beta-like 0.000000504
Further Details:      
 
Domain Number 2 Region: 2-86
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 7.25e-35
Family DNA polymerase beta, N-terminal domain-like 0.0000339
Further Details:      
 
Domain Number 3 Region: 89-143
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 6.22e-18
Family DNA polymerase beta-like, second domain 0.0000777
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5ca7_B
Sequence length 334
Comment mol:protein length:334 DNA polymerase lambda
Sequence
AQPSSQKATNHNLHITEKLEVLAKAYSVQGDKWRALGYAKAINALKSFHKPVTSYQEACS
IPGIGKRMAEKIIEILESGHLRKLDHISESVPVLELFSNIWGAGTKTAQMWYQQGFRSLE
DIRSQASLTTQQAIGLKHYSDFLERMPREEATEIEQTVQKAAQAFNSGLLCVACGSYRRG
KATCGDVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQEENGQQQKYLGVCRLPG
PGRRHRRLDIIVVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSEHALSTAVVRNTH
GCKVGPGRVLPTPTEKDVFRLLGLPYREPAERDW
Download sequence
Identical sequences 4xq8_A 4xq8_B 5ca7_A 5ca7_B 5iii_A 5iij_A 5iik_A 5iil_A 5iim_A 5iin_A 5iio_A 5iio_E 5iio_I 5iio_M

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]