SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5dat_s2 from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5dat_s2
Domain Number 1 Region: 25-239
Classification Level Classification E-value
Superfamily PDB 1.48e-106
Family PDB 0.00000000376
Further Details:      
 
Domain Number 2 Region: 69-140
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 2.22e-20
Family Ribosomal S5 protein, N-terminal domain 0.00074
Further Details:      
 
Domain Number 3 Region: 151-231
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.83e-20
Family Translational machinery components 0.0046
Further Details:      
 
Domain Number 4 Region: 10-55
Classification Level Classification E-value
Superfamily PDB 0.00000000000000698
Family PDB 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5dat_s2
Sequence length 253
Comment mol:protein length:253 40S ribosomal protein S2
Sequence
SAPEAQQQKRGGFGGRNRGRPNRRGPRNTEEKGWVPVTKLGRLVKAGKITTIEEIFLHSL
PVKEFQIIDTLLPGLQDEVMNIKPVQKQTRAGQRTRFKAVVVVGDSNGHVGLGIKTAKEV
AGAIRAGIIIAKLSVIPIRRGYWGTNLGQPHSLATKTTGKCGSVTVRLIPAPRGSGIVAS
PAVKKLLQLAGVEDVYTQSNGKTRTLENTLKAAFVAIGNTYGFLTPNLWAEQPLPVSPLD
IYSDEASAQKKRF
Download sequence
Identical sequences 4u3m_S2 4u3m_s2 4u3n_S2 4u3n_s2 4u3u_S2 4u3u_s2 4u4n_S2 4u4n_s2 4u4o_S2 4u4o_s2 4u4q_S2 4u4q_s2 4u4r_S2 4u4r_s2 4u4u_S2 4u4u_s2 4u4y_S2 4u4y_s2 4u4z_S2 4u4z_s2 4u50_S2 4u50_s2 4u51_S2 4u51_s2 4u52_S2 4u52_s2 4u53_S2 4u53_s2 4u55_S2 4u55_s2 4u56_S2 4u56_s2 4u6f_S2 4u6f_s2 5dat_S2 5dat_s2 5dc3_S2 5dc3_s2 5dge_S2 5dge_s2 5dgf_S2 5dgf_s2 5dgv_S2 5dgv_s2 5fci_S2 5fci_s2 5fcj_S2 5fcj_s2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]