SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5ews_L from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5ews_L
Domain Number 1 Region: 8-133
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.91e-46
Family Galectin (animal S-lectin) 0.0000349
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5ews_L
Sequence length 134
Comment mol:protein length:134 Galectin-2
Sequence
GSHMTGELEVKNMDMKPGSTLKITGSIADGTDGFVINLGQGTDKLNLHFNPRFSESTIVC
NSLDGSNWGQEQREDHLCFSPGSEVKFTVTFESDKFKVKLPDGHELTFPNRLGHSHLSYL
SVRGGFNMSSFKLK
Download sequence
Identical sequences 5ews_A 5ews_B 5ews_C 5ews_D 5ews_E 5ews_F 5ews_G 5ews_H 5ews_I 5ews_J 5ews_K 5ews_L 5ews_M 5ews_N 5ews_O 5ews_P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]