SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5g5n_C from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5g5n_C
Domain Number 1 Region: 24-263
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.97e-16
Family Pectin lyase 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5g5n_C
Sequence length 353
Comment mol:protein length:353 LH3 HEXON-INTERLACING CAPSID PROTEIN
Sequence
GLPVPSPPGTLLPGQSPDEAFARNSVVFLVPGAEYNWKNVVIRKPVWIYGNGATVKTSGL
GPIIHIMGDLDNPMDVRIQDLTFIGGDSPDRLVPFSAVLTNQMALWCIDPRITIRGCSFY
NFGGAAIYLERSERDTGFRFGRGQVMITDCRFRGCRIGIANGGSVEYGLASQNNFSDCQI
CFNVVGGNWTRSGNVASNCRCMYLHTQGMWYEGAAGNFNPAHGSFTSNTLNHCDYGGNLW
PTEFQLPDRVINLAGFYFDNAAARLPNFSGNSQWYGDMKLINFLPDSTFVINGGALYGGP
GDTGVIAVATALAAKVFVIGCQGNAGQQIVNVPAANIIPEVGTRKDDATQPAA
Download sequence
Identical sequences 5g5n_A 5g5n_B 5g5n_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]