SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5g5o_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5g5o_B
Domain Number 1 Region: 44-283
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.34e-16
Family Pectin lyase 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5g5o_B
Sequence length 373
Comment mol:protein length:373 LH3 HEXON-INTERLACING CAPSID PROTEIN
Sequence
MTSVEDLYVVKPINQWPAPSGLPVPSPPGTLLPGQSPDEAFARNSVVFLVPGAEYNWKNV
VIRKPVWIYGNGATVKTSGLGPIIHIMGDLDNPMDVRIQDLTFIGGDSPDRLVPFSAVLT
NQMALWCIDPRITIRGCSFYNFGGAAIYLERSERDTGFRFGRGQVMITDCRFRGCRIGIA
NGGSVEYGLASQNNFSDCQICFNVVGGNWTRSGNVASNCRCMYLHTQGMWYEGAAGNFNP
AHGSFTSNTLNHCDYGGNLWPTEFQLPDRVINLAGFYFDNAAARLPNFSGNSQWYGDMKL
INFLPDSTFVINGGALYGGPGDTGVIAVATALAAKVFVIGCQGNAGQQIVNVPAANIIPE
VGTRKDDATQPAA
Download sequence
Identical sequences 5g5o_A 5g5o_B 5g5o_C 5g5o_D 5g5o_E 5g5o_F

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]