SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5gqg_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5gqg_A
Domain Number 1 Region: 12-150,185-343,403-507,550-596
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.01e-26
Family Pectate transeliminase 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5gqg_A
Sequence length 606
Comment mol:protein length:606 Lacto-N-biosidase
Sequence
MQSATQGKETATTTSSGTTYYVSSAHGDDANAGTSENAPWKSLTKVNDIASDLGPGDSVL
LEYGSEFNDQYLHIKDTAGNADAPITISAYGDADEGKPVIASNGVKGSQWEQDYRANVGN
HKNKGTVSTTLLLKDVSYITVSNLEITNDDADVYDPIDTWKWTDTPDSDGTKLDRSASRM
DRTGVAGIAENGATMSNVTLDNLYIHDVDGNIYNKHMANGGIYFMAHYPMENTSAETDVW
LREHVSRFDHVTIRNSTVKDVDRWGIAVGYTAYLNYIDANYGDGSIDDALIAKYGSTNVR
IENNYVKGAGGDAITLMYCDRPVIEHNVGDSVSKHINTQDYTQPGSYGGRVAAGIWPWRC
KDPVFQYNEMYNNLNAEHGNGDGQAWDADYGDGTLYQYNYSYGNSFASLMICNWYAVNTT
FRYNISQNDRQGVFDLPSNGPGNHIYNNTVYVDADSQVLTKRSNSQSLFENNIFINATNT
KKTETWNRGSQNGGQTYDNNMYVNYANKPTSDANAIEADDVSAVLAGAGSAPTSALKSGA
EHARTGEKAAFDGYRPVAGSKAINAGKVVSDLNDYAVENDFLGNAVKGRPDLGAVEAALE
HHHHHH
Download sequence
Identical sequences 5gqc_A 5gqc_B 5gqc_C 5gqc_D 5gqc_E 5gqc_F 5gqc_G 5gqc_H 5gqf_A 5gqf_B 5gqg_A 5gqg_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]