SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5h9q_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5h9q_B
Domain Number 1 Region: 23-154
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.89e-62
Family Galectin (animal S-lectin) 0.00000767
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5h9q_B
Sequence length 155
Comment mol:protein length:155 Galectin-7
Sequence
GSSHHHHHHSSGLVPRGSHMSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGE
EQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAV
VGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF
Download sequence
Identical sequences 4xbq_A 4xbq_B 5h9q_A 5h9q_B 5h9s_A 5h9s_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]