SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5iol_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5iol_B
Domain Number 1 Region: 3-150
Classification Level Classification E-value
Superfamily Nucleoside diphosphate kinase, NDK 2.35e-89
Family Nucleoside diphosphate kinase, NDK 0.0000319
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5iol_B
Sequence length 150
Comment mol:protein length:150 Nucleoside diphosphate kinase
Sequence
GPERTFIMVKPDGVQRGLVGEVIQRFERRGYKLVAIKMMHASEQLLQTHYEALKSLSFFP
KLVAYMSSGPVVPMVFEGRKVVENGRTMLGATKPEASCPGSIRGDYCQDVGRNVVHGSDS
TESANREINLWFSPQELCQYKQAVDPWIHE
Download sequence
Identical sequences 002036700|e5iolD1|304.34.1.1|D:1-150 002036702|e5iolF1|304.34.1.1|F:1-150 002036704|e5iolH1|304.34.1.1|H:1-150 002036708|e5iolL1|304.34.1.1|L:1-150 002099272|e5iomA1|304.34.1.1|A:1-150 5iol_A 5iol_B 5iol_C 5iol_D 5iol_E 5iol_F 5iol_G 5iol_H 5iol_I 5iol_J 5iol_K 5iol_L 5iom_A 5iom_B 5kk8_A 5kk8_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]