SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5j7l_AE from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5j7l_AE
Domain Number 1 Region: 70-150
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.2e-27
Family Translational machinery components 0.0000133
Further Details:      
 
Domain Number 2 Region: 2-66
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.27e-23
Family Ribosomal S5 protein, N-terminal domain 0.0000232
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5j7l_AE
Sequence length 155
Comment mol:protein length:155 30S ribosomal protein S5
Sequence
ELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAMEKARR
NMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVHNVLAKAYG
STNPINVVRATIDGLENMNSPEMVAAKRGKSVEEI
Download sequence
Identical sequences 4ybb_AE 4ybb_BE 5it8_AE 5it8_BE 5j5b_AE 5j5b_BE 5j7l_AE 5j7l_BE 5j88_AE 5j88_BE 5j8a_AE 5j8a_BE 5j91_AE 5j91_BE 5jc9_AE 5jc9_BE 5no2_E 5no3_E 5no4_E

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]