SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5js4_C from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5js4_C
Domain Number 1 Region: 241-515
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000203
Family iota-carrageenase 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5js4_C
Sequence length 719
Comment mol:protein length:719 phiAB6 tailspike
Sequence
MGSSHHHHHHSSGLVPRGSHMNILRSFTETVVTTPTDIFPISFEYDEKYDAVHVFLNDVA
VEDLGYTVSQVNAVTLKIEPAIPDGTVRIERETDIDKMKYIFDAGALFIDQNVDADFRQI
VHSQQEVRDGFIKLRGDVLPLVHGLQEALQQAQEASEAAQEAANAAEVAASQTQYYLKYF
NPEIVYPKNARIMLDNGDIVRSTVVNNTSNPNVDMTGWVKVSSVSQIFDETYNITQSVIN
GNLITVDNFGAKGDGVTDDSAAFQAYCDSALTGQNLYLGAKGRYILKNQVDLKGKGLVGN
GCGKVSEFYYNLGCIDVDGSSPDLQGKTAFINCGPTIQNLTARCSNGAGKQVSFIEIDGY
LANIDHITLINFYNQIVVKQALVGFNFTNAWLYYSQNAGIYCEDPLNRVSTTGTFHNIYF
QLGDGHAMIFDRDVHGCDFDNIIFESMNGGIKARTVAHCGFGKFWCENLKTATSKDWLEV
TGANSCYGNSFTGYVKLLGGWTSKTSPTLDSLPTNNYGGVSVSAEGISIVNAGNKAKMLM
LPSGFKTGNATIDETHISSSTVTPLVKRRVIGADSSGAQYLASDTYTKLSRKWGTYNHGS
NNAGAFYAPMMLTYDQSFSTPQNNNGWKIVKESTGVYRVERVSGNTSVITNGHIVVGSPL
MGSRLGTGTGATHGIQMIETYAGSWTSYTEAAGFKVFWRDSSNALVDPHRFTVAFTATS
Download sequence
Identical sequences 5js4_A 5js4_B 5js4_C 5jsd_A 5jsd_B 5jsd_C 5jse_A 5jse_B 5jse_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]