SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5ke1_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5ke1_A
Domain Number 1 Region: 146-168,195-320
Classification Level Classification E-value
Superfamily Pectin lyase-like 5.27e-38
Family Virulence factor P.69 pertactin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5ke1_A
Sequence length 341
Comment mol:protein length:341 Outer membrane protein IcsA autotransporter
Sequence
GFGNNVKVEAIINNWAQKDYKLLSADKGITGFSVSNISIINPLLTTGAIDYTKSYISDQN
KLIYGLSWNDTDGDSHGEFNLKENAELTVSTILADNLSHHNINSWDGKSLTKSGEGTLIL
AEKNTYSGFTNINAGILKMGTVEAMTRTAGVIVNKGATLNFSGMNQTVNTLLNSGTVLIN
NINAPFLPDPVIVTGNMTLEKNGHVILNNSSSNVGQTYVQKGNWHGKGGILSLGAVLGND
NSKTDRLEIAGHASGITYVAVTNEGGSGDKTLEGVQIISTDSSDKNAFIQKGRIVAGSYD
YRLKQGTVSGLNTNKWYLTSQMDNQESKQMSNQESTQMSSR
Download sequence
Identical sequences 5ke1_A 5ke1_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]