SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5mqp_E from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5mqp_E
Domain Number 1 Region: 21-121,375-594
Classification Level Classification E-value
Superfamily Pectin lyase-like 5.38e-25
Family Pectate transeliminase 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5mqp_E
Sequence length 624
Comment mol:protein length:624 Glycoside hydrolase BT_1002
Sequence
MGSSHHHHHHSSGPQQGLRHLLSAGEIWISPQGNDLNDGTRPSPKATLTSALRQAREWRR
TDDERVRGGITICMEGGTYALYEPVFIRPEDSGTEDSPTVIRPVADEKVVLSGGIRIGGW
KKQGKLWVADVPMFNGRPLDFRQLWVNGKKAVRARDVEDFEKMNRICSVDEKNEILYVPA
VAIRRLVDGKGALKAKYAEMVLHQMWCVANLRIRSVELAGDSAAIRFHQPESRIQFEHPW
PRPMVTTDGHNSAFYLTNARELLDVAGEWYHDIDARKVYYYPREGEKLQDAGTEVIVPAI
ETLIQVKGTFDRPVSHIRFEKITFSHTTWMRPSEKGHVPLQAGMYLTDGYRIDPKMERDY
LNHPLDNQGWLGRPAAAVSVAAANQIDFERCRFDHLGSTGLDYEEAVQGGVVRGCLFRDI
AGNGLVVGSFSPAAHETHLPYDPTDLREVCAHQQISNCYFTEVGNEDWGCLAILAGYVKD
INIEHNEICEVPYSGISLGWGWTQTVNCMRNNRVHANLIHHYAKHMYDVAGVYTLGSQPK
SYVTENCVHSIYKPGYVHDPNHWFYLYTDEGSSFITVRDNWTEGEKYLQNANGPGNVWEN
NGPQVDTVIRERAGLEAEYRDLKK
Download sequence
Identical sequences 5mqp_A 5mqp_B 5mqp_C 5mqp_D 5mqp_E 5mqp_F 5mqp_G 5mqp_H

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]