SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5ndl_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5ndl_A
Domain Number 1 Region: 54-238
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.62e-73
Family Glycosyl hydrolases family 16 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5ndl_A
Sequence length 260
Comment mol:protein length:260 Crh-like protein
Sequence
HHHHHHWSKCNPLEKTCPPNKGLAASTYTADFTSASALDQWEVTAGKVPVGPQGAEFTVA
KQGDAPTIDTDFYFFFGKAEVVMKAAPGTGVVSSIVLESDDLDEVDWEVLGGDTTQVQTN
YFGKGDTTTYDRGTYVPVATPQETFHTYTIDWTKDAVTWSIDGAVVRTLTYNDAKGGTRF
PQTPMRLRLGSWAGGDPSNPKGTIEWAGGLTDYSAGPYTMYVKSVRIENANPAESYTYSD
NSGSWQSIKFDGSVDISSSS
Download sequence
Identical sequences 5ndl_A 5ndl_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]