SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5olp_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5olp_A
Domain Number 1 Region: 49-169,196-429
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.52e-122
Family Galacturonase 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5olp_A
Sequence length 452
Comment mol:protein length:452 Pectate lyase
Sequence
MGSSHHHHHHSSGPQQGLRQYKTVKVKAPFPMQPIKVFIYPDRDFKITDFGAVPGGEVDN
TKAIAAAIDACNKAGGGRVVVPAGIWLTGPVHFKSNINLCLEEDAVLSFTDNPEDYLPAV
MTSWEGLECYNYSPLLYAFECENVAISGKGTLQPKMGTWKVWFKRPAPHLQALKELYTKA
STNVPVIERQMAIGENHLRPHLIHFNRCKNVMLDGFKIRESPFWTIHLYMCDGGIVRNLD
VRAHGHNNDGIDFEMSRNFLVEDCSFDQGDDAVVIKAGRNQDAWRLNTPCENIVIRNCRI
LKGHTLLGIGSEISGGIRNIYMHDCTAPNSVMRLFFVKTNHRRGGFIENIYMKNVASGTA
QRVLEIDTEVLYQWKDLVPTYEKRITRIDGIYMDKVTCESADAVYELKGNAELPVKNVRI
KDVKVGSVKKFVKKVSNVENVVEKNVTYSQKD
Download sequence
Identical sequences 5olp_A 5olp_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]