SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5olr_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5olr_B
Domain Number 1 Region: 2-416
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.37e-51
Family Pectate transeliminase 0.0000082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5olr_B
Sequence length 522
Comment mol:protein length:522 Rhamnogalacturonan lyase
Sequence
MGKTYYMDPEGSDSNPGTSDKPFATLVKVQEVVVAGDVVYINPGTYVVPANQVPMTTTNS
GLYHCVFHMNKSGEAGKPISYLANPNKQGRPIFDLSQVKPKDQRITVFYVTGSNLYLKGF
DVIGTQVTITGHTQSECFRIVKGANNNKFEDLRTHDGMAIGFYLLGGSNNHILNCDAYNN
YDSVSEGGKGGNVDGFGGHINSSSVGEGKGTGNVFEGCRAWYNSDDGFDLINCFEAVKII
NCWSFLNGYKPGTKEVAGDGTGFKAGGYGMAADKLPAIPSVIPQHEVRNSLAYYNRLRGF
YANHHLGGIIFESNTAVNSGENYNMTNRESPLALPPTDVNGYDHMVKNNLSLVTRSGSKH
IVMVNRAKSEVSNNSFDGSEEVIETDFISLEEAELMRDRKPNGDLPDVNFGKLTTDAELR
FWGMGCFATGEPTDLDFGWLKKPTIVVVGSKASVVGPEAASFTKMYVIVDGEETTEFDKN
SIDLSDFSGVLEVKAVIEDANGNITKSIALKFKRLEHHHHHH
Download sequence
Identical sequences 5olq_A 5olq_B 5olq_C 5olr_A 5olr_B 5olr_C 5ols_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]