SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5vzi_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5vzi_A
Domain Number 1 Region: 166-219,254-353
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.93e-69
Family SCOPe 0.00066
Further Details:      
 
Domain Number 2 Region: 13-99
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 7.25e-34
Family SCOPe 0.0033
Further Details:      
 
Domain Number 3 Region: 103-160
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 3.93e-18
Family DNA polymerase beta-like, second domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5vzi_A
Sequence length 354
Comment mol:protein length:354 DNA-directed DNA/RNA polymerase mu
Sequence
GSAAASPAWMPAYACQRPTPLTHHNTGLSEALEILAEAAGFEGSEGRLLTFCRAASVLKA
LPSPVTTLSQLQGLPHFGEHSSRVVQELLEHGVCEEVERVRRSERYQTMKLFTQIFGVGV
KTADRWYREGLRTLDDLREQPQKLTQQQKAGLQHHQDLSTPVLRSDVDALQQVVEEAVGQ
ALPGATVTLTGGFRRGKLQGHDVDFLITHPKEGQEAGLLPRVMCRLQDQGLILYHQHQHS
CCESPTRLAQQSHMDAFERSFCIFRLPQPGSWKAVRVDLVVAPVSQFPFALLGHTGSKLF
QRELRRFSRKEKGLWLNSHGLFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRNA
Download sequence
Identical sequences 5vzg_A 5vzh_A 5vzi_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]