SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5wwv_H from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5wwv_H
Domain Number 1 Region: 1-208,272-334
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2.57e-31
Family D-aminoacid oxidase, N-terminal domain 0.00000000562
Further Details:      
 
Domain Number 2 Region: 195-287
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 9.52e-21
Family D-aminoacid oxidase-like 0.00000154
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5wwv_H
Sequence length 347
Comment mol:protein length:347 D-amino-acid oxidase
Sequence
MRVVVIGAGVIGLSTALCIHERYHSVLQPLDVKVYADRFTPFTTTDVAAGLWQPYTSEPS
NPQEANWNQQTFNYLLSHIGSPNAANMGLTPVSGYNLFREAVPDPYWKDMVLGFRKLTPR
ELDMFPDYRYGWFNTSLILEGRKYLQWLTERLTERGVKFFLRKVESFEEVARGGADVIIN
CTGVWAGVLQPDPLLQPGRGQIIKVDAPWLKNFIITHDLERGIYNSPYIAPGLQAVTLGG
TFQVGNWNEINNIQDHNTIWEGCCRLEPTLKDAKIVGEYTGFGPVRPQVRLEREQLRFGS
SNTEVIHNYGHGGYGLTIHWGCALEVAKLFGKVLEERNLLTMPPSHL
Download sequence
Identical sequences 5wwv_A 5wwv_B 5wwv_C 5wwv_D 5wwv_E 5wwv_F 5wwv_G 5wwv_H 5wx2_A 5wx2_B 5wx2_C 5wx2_D 5wx2_E 5wx2_F 5wx2_G 5wx2_H

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]