SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1aih_C from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1aih_C
Domain Number 1 Region: 5-161
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 1.61e-40
Family Lambda integrase-like, catalytic core 0.00000004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 1aih_C
Sequence length 170
Comment mol:protein length:170 HP1 INTEGRASE
Sequence
etelaflyerdiyrllaecdnsrnpdlglivriclatgarwseaetltqsqvmpykitft
ntkskknrtvpisdelfdmlpkkrgrlfndayesfenavlraeielpkgqlthvlrhtfa
shfmmnggnilvlkeilghstiemtmryahfapshlesavkfnplsnpaq
Download sequence
Identical sequences 1aih_A 1aih_B 1aih_C 1aih_D 1aihA cath|current|1aihA00/168-337 cath|current|1aihB00/170-337 cath|current|1aihC00/170-337 cath|current|1aihD00/168-337 d1aiha_ d1aihd_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]