SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1bwe_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1bwe_A
Domain Number 1 Region: 2-74
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 2.71e-21
Family 7-Fe ferredoxin 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1bwe_A
Sequence length 77
Comment mol:protein length:77 PROTEIN (FERREDOXIN)
Sequence
ayvitepcigtkcascvevcpvdcihegedqyyidpdvcidcgaceavcpvsaiyhedfv
peewksyiqknrdffkk
Download sequence
Identical sequences 1bqx_A 1bwe_A 000067006|e1bweA1|205.1.1.6|A:1-77 000067008|e1bqxA1|205.1.1.6|A:1-77 cath|current|1bqxA00/1-77 cath|current|1bweA00/1-77 d1bqxa_ d1bwea_ 1bweA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]