SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1c3y_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1c3y_A
Domain Number 1 Region: 2-107
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 2.64e-28
Family Insect pheromone/odorant-binding proteins 0.00000273
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1c3y_A
Sequence length 108
Comment mol:protein length:108 THP12 CARRIER PROTEIN
Sequence
etpreklkqhsdackaesgvseeslnkvrnreevddpklkehafcilkragfidasgefq
ldhiktkfkensehpekvddlvakcavkkdtpqhssadffkcvhdnrs
Download sequence
Identical sequences 000003201|e1c3yA1|108.2.1.1|A:1-108 000049450|e1c3zA1|108.2.1.1|A:1-108 cath|current|1c3yA00/1-108 cath|current|1c3zA00/1-108 d1c3ya_ d1c3za_ 1c3yA 1c3y_A 1c3z_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]