SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1czf_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1czf_B
Domain Number 1 Region: 45-355
Classification Level Classification E-value
Superfamily Pectin lyase-like 4.58e-109
Family Galacturonase 0.000000000341
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1czf_B
Sequence length 362
Comment mol:protein length:362 POLYGALACTURONASE II
Sequence
MHSFASLLAYGLVAGATFASASPIEARDSCTFTTAAAAKAGKAKCSTITLNNIEVPAGTT
LDLTGLTSGTKVIFEGTTTFQYEEWAGPLISMSGEHITVTGASGHLINCDGARWWDGKGT
SGKKKPKFFYAHGLDSSSITGLNIKNTPLMAFSVQANDITFTDVTINNADGDTQGGHNTD
AFDVGNSVGVNIIKPWVHNQDDCLAVNSGENIWFTGGTCIGGHGLSIGSVGDRSNNVVKN
VTIEHSTVSNSENAVRIKTISGATGSVSEITYSNIVMSGISDYGVVIQQDYEDGKPTGKP
TNGVTIQDVKLESVTGSVDSGATEIYLLCGSGSCSDWTWDDVKVTGGKKSTACKNFPSVA
SC
Download sequence
Identical sequences A0A2K4ZZL6 A2R5S4 P26214
e_gw1_6.364.1 CADANGAP00011984 XP_001397067.1.80561 5061.CADANGAP00011984 1czf_A 1czf_B 1czfA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]