SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1d3w_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1d3w_A
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 4.67e-25
Family 7-Fe ferredoxin 0.00000375
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1d3w_A
Sequence length 106
Comment mol:protein length:106 FERREDOXIN 1
Sequence
afvvtdncikckytecvevcpvdcfyegpnflvihpdecidcalcepecpaqaifsedev
pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler
Download sequence
Identical sequences 000067004|e1d3wA1|205.1.1.3|A:1-106 cath|current|1d3wA00/1-106 d1d3wa_ 1d3w_A 1d3wA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]