SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1efp_C from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1efp_C
Domain Number 1 Region: 185-307
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 3.54e-49
Family C-terminal domain of the electron transfer flavoprotein alpha subunit 0.00000105
Further Details:      
 
Domain Number 2 Region: 2-182
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.96e-45
Family ETFP subunits 0.0000000267
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1efp_C
Sequence length 307
Comment mol:protein length:307 PROTEIN (ELECTRON TRANSFER FLAVOPROTEIN)
Sequence
avlllgevtngalnrdatakavaavkalgdvtvlcagasakaaaeeaakiagvakvlvae
dalyghrlaeptaalivglagdyshiaapattdaknvmprvaalldvmvlsdvsaildad
tferpiyagnaiqvvkskdakkvftirtasfdaageggtapvtetaaaadpglsswvade
vaesdrpeltsarrvvsggrglgskesfaiieeladklgaavgasraavdsgyapndwqv
gqtgkvvapelyvavgisgaiqhlagmkdskvivainkdeeapifqiadyglvgdlfsvv
peltgkl
Download sequence
Identical sequences 1efpA 1efp_A 1efp_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]