SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1efv_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1efv_A
Domain Number 1 Region: 3-189
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.01e-59
Family ETFP subunits 0.0000000126
Further Details:      
 
Domain Number 2 Region: 192-311
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 2.61e-50
Family C-terminal domain of the electron transfer flavoprotein alpha subunit 0.00000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1efv_A
Sequence length 315
Comment mol:protein length:315 ELECTRON TRANSFER FLAVOPROTEIN
Sequence
mqstlviaehandslapitlntitaatrlggevsclvagtkcdkvaqdlckvagiakvlv
aqhdvykgllpeeltplilatqkqfnythicagasafgknllprvaaklevapisdiiai
kspdtfvrtiyagnalctvkcdekvkvfsvrgtsfdaaatsggsassekasstspveise
wldqkltksdrpeltgakvvvsggrglksgenfkllydladqlhaavgasraavdagfvp
ndmqvgqtgkivapelyiavgisgaiqhlagmkdsktivainkdpeapifqvadygivad
lfkvvpemteilkkk
Download sequence
Identical sequences 1efvA 1efv_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]