SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1etq_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1etq_B
Domain Number 1 Region: 4-98
Classification Level Classification E-value
Superfamily Homeodomain-like 3.01e-26
Family FIS-like 0.00000476
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1etq_B
Sequence length 98
Comment mol:protein length:98 FACTOR FOR INVERSION STIMULATION
Sequence
mfeqrvnsdvltvstvnsqdqvtqkplrdsvkqalknyfaqlngqdvndlyelvlaeveq
plldmvmqytygnqtraalmmginrgtlrkklkkygmn
Download sequence
Identical sequences 1etqA cath|current|1etqA00/10-98 cath|current|1etqB00/10-98 cath|current|1etqC00/11-98 cath|current|1etqD00/10-98 1etq_A 1etq_B 1etq_C 1etq_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]