SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1fav_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1fav_A
Domain Number 1 Region: 35-79
Classification Level Classification E-value
Superfamily Virus ectodomain 2.55e-43
Family Virus ectodomain 0.00019
Further Details:      
 
Domain Number 2 Region: 1-29
Classification Level Classification E-value
Superfamily Leucine zipper domain 4.88e-19
Family Leucine zipper domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1fav_A
Sequence length 79
Comment mol:protein length:79 HIV-1 ENVELOPE PROTEIN CHIMERA
Sequence
qiedkieeilskiyhieneiarikkligearqllsgivqqqnnllraieaqqhllqltvw
gikqlqarilaverylkdq
Download sequence
Identical sequences 1favA 1fav_A cath|current|1favA00/2-79

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]