SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1fd2_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1fd2_A
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.28e-22
Family 7-Fe ferredoxin 0.00000354
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1fd2_A
Sequence length 106
Comment mol:protein length:106 FERREDOXIN
Sequence
afvvtdncikckytdcvevapvdcfyegpnflvihpdecidcalcepecpaqaifsedev
pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler
Download sequence
Identical sequences 1fd2_A 1fd2A 000067001|e1fd2A1|205.1.1.4|A:1-106 cath|current|1fd2A00/1-106 d1fd2a_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]