SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1fvq_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1fvq_A
Domain Number 1 Region: 6-68
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 9.53e-25
Family HMA, heavy metal-associated domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 1fvq_A
Sequence length 72
Comment mol:protein length:72 COPPER-TRANSPORTING ATPASE
Sequence
arevilavhgmtcsactntintqlralkgvtkcdislvtnecqvtydnevtadsikeiie
dcgfdceilrds
Download sequence
Identical sequences 2ggpB 000005140|e2ggpB1|304.3.1.7|B:1-72 000064403|e1fvsA1|304.3.1.7|A:1-72 000064404|e1fvqA1|304.3.1.7|A:1-72 cath|current|1fvqA00/1-72 cath|current|1fvsA00/1-72 cath|current|2ggpB00/1-72 1fvq_A 1fvs_A 2ggp_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]