SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1gao_C from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1gao_C
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 5.53e-25
Family 7-Fe ferredoxin 0.00000422
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1gao_C
Sequence length 106
Comment mol:protein length:106 FERREDOXIN I
Sequence
afvvtdncikckytdcvevcpvdcfyegpnflvihpdecidcascepecpaqaifsedev
pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler
Download sequence
Identical sequences 000066969|e1gaoA1|205.1.1.3|A:1-106 000066972|e1gaoC1|205.1.1.3|C:1-106 000066973|e1gaoB1|205.1.1.3|B:1-106 000066998|e1gaoD1|205.1.1.3|D:1-106 cath|current|1gaoA00/1-106 cath|current|1gaoB00/201-306 cath|current|1gaoC00/401-506 cath|current|1gaoD00/601-706 d1gaoa_ d1gaob_ d1gaoc_ d1gaod_ 1gaoA 1gao_A 1gao_B 1gao_C 1gao_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]