SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1hf0_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1hf0_B
Domain Number 1 Region: 5-74
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 7.41e-63
Family POU-specific domain 0.0026
Further Details:      
 
Domain Number 2 Region: 79-158
Classification Level Classification E-value
Superfamily Homeodomain-like 3.39e-19
Family Homeodomain 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 1hf0_B
Sequence length 159
Comment mol:protein length:159 OCTAMER-BINDING TRANSCRIPTION FACTOR 1
Sequence
eepsdleeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknm
sklkpllekwlndaenlssdsslsspsalnspgieglsrrrkkrtsietnirvaleksfl
enqkptseeitmiadqlnmekevirvwfsnrrqkekrin
Download sequence
Identical sequences 1gt0_C 1hf0_A 1hf0_B 1gt0C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]