SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1i5n_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1i5n_A
Domain Number 1 Region: 7-104
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 2.64e-38
Family Chemotaxis protein CheA P1 domain 0.00000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1i5n_A
Sequence length 146
Comment mol:protein length:146 CHEMOTAXIS PROTEIN CHEA
Sequence
msmdisdfyqtffdeadelladmeqhlldlvpespdaeqlnaifraahsikggagtfgft
ilqetthlmenlldearrgemqlntdiinlfletkdimqeqldayknseepdaasfeyic
nalrqlaleakgettpavrshhhhhh
Download sequence
Identical sequences 1i5nA 1i5n_A 1i5n_B 1i5n_C 1i5n_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]